PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DL_57F246ADF.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 153aa    MW: 17143.6 Da    PI: 10.7013
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DL_57F246ADF.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.7e-164289148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+ Ed +l  +vk++G  +W+ + +  g+ R++k+c++rw ++l
  Traes_1DL_57F246ADF.1 42 KGPWTPAEDAILEAYVKKHGVQNWNVVQKDTGLLRCGKSCRLRWANHL 89
                           79******************************99**********9996 PP

2Myb_DNA-binding24.46.8e-0895124131
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartm 31 
                            +g +T+eE+ l+++++ ++G++ W++ a+++
  Traes_1DL_57F246ADF.1  95 KGTFTKEEENLIIKLHSKMGNK-WARMAARV 124
                            799*******************.***99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.813793IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-223892IPR009057Homeodomain-like
SMARTSM007172.0E-134191IPR001005SANT/Myb domain
PfamPF002491.6E-144289IPR001005SANT/Myb domain
SuperFamilySSF466893.79E-2443119IPR009057Homeodomain-like
CDDcd001671.50E-104489No hitNo description
PROSITE profilePS500906.59790124IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.0E-1493124IPR009057Homeodomain-like
SMARTSM007170.4494147IPR001005SANT/Myb domain
PfamPF002495.3E-795124IPR001005SANT/Myb domain
CDDcd001670.0024197124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MTRAKSESGR EMPGPDQADL ASRDDDSARE SPRRRAGPQL KKGPWTPAED AILEAYVKKH  60
GVQNWNVVQK DTGLLRCGKS CRLRWANHLR PDLKKGTFTK EEENLIIKLH SKMGNKWARM  120
AARVSSVSSS YFSGSAFIKF CSHASLVRVG FLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-202012136136MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-202012136136MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-20171212105MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519000.0JF951900.1 Triticum aestivum clone TaMYB15 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564452.11e-53PREDICTED: transcription factor GAMYB-like
SwissprotA2WW871e-54GAM1_ORYSI; Transcription factor GAMYB
TrEMBLW5AF011e-112W5AF01_WHEAT; Uncharacterized protein
STRINGBRADI2G53010.14e-53(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39473664
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.24e-45myb domain protein 101
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]